PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf09962g01012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GATA
Protein Properties Length: 258aa    MW: 28396.4 Da    PI: 10.6056
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf09962g01012.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.77.9e-19172206135
                      GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                               C++C +t Tp+WR+gp g+ktLCnaCG++yr+ +l
  Niben101Scf09962g01012.1 172 CTHCEVTRTPQWREGPLGPKTLCNACGVRYRSGRL 206
                               *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.2E-14166220IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.398166202IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.8E-14166228No hitNo description
Gene3DG3DSA:3.30.50.108.4E-14171203IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.23E-14171218No hitNo description
PfamPF003209.3E-17172206IPR000679Zinc finger, GATA-type
PROSITE patternPS003440172197IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MTFPWGLSSM KTLKAYSIVW TSPWKVWKKT ASVNEDFESI LNSLDFPLES LEDDGLGGDW  60
DPSLYQLLGP IPADALPPVS RNANGWLNAA TQSPISVLEH KSSCSGGKST SSNFGTKGRR  120
SKRARSSTLN PWILMAPTSS TAFAGKKNSD AKKRRKLSQQ SSVMNSSLFK KCTHCEVTRT  180
PQWREGPLGP KTLCNACGVR YRSGRLLPEY RPAASPTFVP SLHSNSHRKV IEMRRNAVEG  240
SVVWLKVGVQ KWDAGVIG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1151155KKRRK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009774660.11e-130PREDICTED: GATA transcription factor 11-like
RefseqXP_016486021.11e-130PREDICTED: GATA transcription factor 11-like
SwissprotQ6DBP83e-48GAT11_ARATH; GATA transcription factor 11
TrEMBLK4C9N05e-94K4C9N0_SOLLC; Uncharacterized protein
STRINGSolyc06g075140.2.11e-93(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31342149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.24e-48GATA transcription factor 11